| # Licensed to the Apache Software Foundation (ASF) under one or more |
| # contributor license agreements. See the NOTICE file distributed with |
| # this work for additional information regarding copyright ownership. |
| # The ASF licenses this file to You under the Apache License, Version 2.0 |
| # (the "License"); you may not use this file except in compliance with |
| # the License. You may obtain a copy of the License at |
| # |
| # http://www.apache.org/licenses/LICENSE-2.0 |
| # |
| # Unless required by applicable law or agreed to in writing, software |
| # distributed under the License is distributed on an "AS IS" BASIS, |
| # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. |
| # See the License for the specific language governing permissions and |
| # limitations under the License. |
| |
| jasper.error.emptybodycontent.nonempty=According to TLD, tag [{0}] must be empty, but is not |
| |
| jsp.engine.info=Jasper JSP {0} Engine |
| jsp.error.action.isnottagfile=[{0}] action can be used in tag files only |
| jsp.error.action.istagfile=[{0}] action cannot be used in a tag file |
| jsp.error.attempt_to_clear_flushed_buffer=Error: Attempt to clear a buffer that's already been flushed |
| jsp.error.attr.quoted=Attribute value should be quoted |
| jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute [{0}] does not accept any expressions |
| jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in the same attribute value |
| jsp.error.attribute.duplicate=Attribute qualified names must be unique within an element |
| jsp.error.attribute.invalidPrefix=The attribute prefix [{0}] does not correspond to any imported tag library |
| jsp.error.attribute.noequal=equal symbol expected |
| jsp.error.attribute.noescape=Attribute value [{0}] is quoted with [{1}] which must be escaped when used within the value |
| jsp.error.attribute.noquote=quote symbol expected |
| jsp.error.attribute.nowhitespace=The JSP specification requires that an attribute name is preceded by whitespace |
| jsp.error.attribute.null_name=Null attribute name |
| jsp.error.attribute.standard.non_rt_with_expr=The [{0}] attribute of the [{1}] standard action does not accept any expressions |
| jsp.error.attribute.unterminated=attribute value for [{0}] is not properly terminated |
| jsp.error.bad.scratch.dir=The scratchDir you specified: [{0}] is unusable. |
| jsp.error.badStandardAction=Invalid standard action |
| jsp.error.bad_attribute=Attribute [{0}] invalid for tag [{1}] according to TLD |
| jsp.error.bad_tag=No tag [{0}] defined in tag library imported with prefix [{1}] |
| jsp.error.beans.nobeaninfo=No BeanInfo for the bean of type [{0}] could be found, the class likely does not exist. |
| jsp.error.beans.nomethod=Cannot find a method to read property [{0}] in a bean of type [{1}] |
| jsp.error.beans.nomethod.setproperty=Cannot find a method to write property [{0}] of type [{1}] in a bean of type [{2}] |
| jsp.error.beans.noproperty=Cannot find any information on property [{0}] in a bean of type [{1}] |
| jsp.error.beans.nullbean=Attempted a bean operation on a null object. |
| jsp.error.beans.property.conversion=Unable to convert string [{0}] to class [{1}] for attribute [{2}]: [{3}] |
| jsp.error.beans.propertyeditor.notregistered=Property Editor not registered with the PropertyEditorManager |
| jsp.error.beans.setproperty.noindexset=Cannot set indexed property |
| jsp.error.bug48498=Unable to display JSP extract. Probably due to an XML parser bug (see Tomcat bug 48498 for details). |
| jsp.error.classname=Cannot determine classname from .class file |
| jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute [{0}]. |
| jsp.error.compilation=Error compiling file: [{0}] [{1}] |
| jsp.error.compiler=No Java compiler available |
| jsp.error.compiler.config=No Java compiler available for configuration options compilerClassName: [{0}] and compiler: [{1}] |
| jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group [{0}] is different from that specified in page directive [{1}] |
| jsp.error.corresponding.servlet=Generated servlet error:\n |
| jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries. |
| jsp.error.data.file.processing=Error processing file [{0}] |
| jsp.error.data.file.read=Error reading file [{0}] |
| jsp.error.data.file.write=Error while writing data file |
| jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot be both 'true' |
| jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature if 'deferredMethod' is not 'true' |
| jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if 'deferredValue' is not 'true' |
| jsp.error.directive.isnottagfile=[{0}] directive can only be used in a tag file |
| jsp.error.directive.istagfile=[{0}] directive cannot be used in a tag file |
| jsp.error.duplicate.name.jspattribute=The attribute [{0}] specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute |
| jsp.error.duplicateqname=An attribute with duplicate qualified name [{0}] was found. Attribute qualified names must be unique within an element. |
| jsp.error.dynamic.attributes.not.implemented=The [{0}] tag declares that it accepts dynamic attributes but does not implement the required interface |
| jsp.error.el.parse=[{0}] : [{1}] |
| jsp.error.el.template.deferred=#{...} is not allowed in template text |
| jsp.error.el_interpreter_class.instantiation=Failed to load or instantiate ELInterpreter class [{0}] |
| jsp.error.fallback.invalidUse=jsp:fallback must be a direct child of jsp:plugin |
| jsp.error.file.already.registered=Recursive include of file [{0}] |
| jsp.error.file.cannot.read=Cannot read file: [{0}] |
| jsp.error.file.not.found=JSP file [{0}] not found |
| jsp.error.file.not.registered=file [{0}] not seen in include |
| jsp.error.flush=Exception occurred when flushing data |
| jsp.error.fragmentwithtype=Cannot specify both ''fragment'' and ''type'' attributes. If ''fragment'' is present, ''type'' is fixed as ''{0}'' |
| jsp.error.function.classnotfound=The class [{0}] specified in TLD for the function [{1}] cannot be found: [{2}] |
| jsp.error.include.exception=Unable to include [{0}] |
| jsp.error.include.tag=Invalid jsp:include tag |
| jsp.error.internal.filenotfound=Internal Error: File [{0}] not found |
| jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: [{0}] |
| jsp.error.invalid.attribute=[{0}] has invalid attribute: [{1}] |
| jsp.error.invalid.bean=The value for the useBean class attribute [{0}] is invalid. |
| jsp.error.invalid.directive=Invalid directive |
| jsp.error.invalid.expression=[{0}] contains invalid expression(s): [{1}] |
| jsp.error.invalid.implicit=Invalid implicit TLD for tag file at [{0}] |
| jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag file at [{0}] |
| jsp.error.invalid.scope=Illegal value of ''scope'' attribute: [{0}] (must be one of "page", "request", "session", or "application") |
| jsp.error.invalid.tagdir=Tag file directory [{0}] does not start with "/WEB-INF/tags" |
| jsp.error.invalid.version=Invalid JSP version defined for tag file at [{0}] |
| jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0 |
| jsp.error.java.line.number=An error occurred at line: [{0}] in the generated java file: [{1}] |
| jsp.error.javac=Javac exception |
| jsp.error.javac.env=Environment: |
| jsp.error.jspbody.emptybody.only=The [{0}] tag can only have jsp:attribute in its body. |
| jsp.error.jspbody.invalidUse=jsp:body must be the subelement of a standard or custom action |
| jsp.error.jspbody.required=Must use jsp:body to specify tag body for [{0}] if jsp:attribute is used. |
| jsp.error.jspc.missingTarget=Missing target: Must specify -webapp or -uriroot, or one or more JSP pages |
| jsp.error.jspc.no_uriroot=The uriroot is not specified and cannot be located with the specified JSP file(s) |
| jsp.error.jspc.uriroot_not_dir=The -uriroot option must specify a pre-existing directory |
| jsp.error.jspelement.missing.name=Mandatory XML-style 'name' attribute missing |
| jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple occurrences of [{0}] with different values (old: [{1}], new: [{2}]) |
| jsp.error.jspoutput.doctypenamesystem=<jsp:output>: 'doctype-root-element' and 'doctype-system' attributes must appear together |
| jsp.error.jspoutput.doctypepublicsystem=<jsp:output>: 'doctype-system' attribute must appear if 'doctype-public' attribute appears |
| jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard syntax |
| jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body |
| jsp.error.jsproot.version.invalid=Invalid version number: [{0}], must be "1.2", "2.0", "2.1" or "2.2" |
| jsp.error.jsptext.badcontent='<', when appears in the body of <jsp:text>, must be encapsulated within a CDATA |
| jsp.error.lastModified=Unable to determine last modified date for file [{0}] |
| jsp.error.library.invalid=JSP page is invalid according to library [{0}]: [{1}] |
| jsp.error.literal_with_void=A literal value was specified for attribute [{0}] that is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal values in this case |
| jsp.error.loadclass.taghandler=Unable to load tag handler class [{0}] for tag [{1}] |
| jsp.error.location=line: [{0}], column: [{1}] |
| jsp.error.mandatory.attribute=[{0}]: Mandatory attribute [{1}] missing |
| jsp.error.missing.tagInfo=TagInfo object for [{0}] is missing from TLD |
| jsp.error.missing_attribute=According to the TLD or the tag file, attribute [{0}] is mandatory for tag [{1}] |
| jsp.error.missing_var_or_varReader=Missing 'var' or 'varReader' attribute |
| jsp.error.namedAttribute.invalidUse=jsp:attribute must be the subelement of a standard or custom action |
| jsp.error.needAlternateJavaEncoding=Default java encoding [{0}] is invalid on your java platform. An alternate can be specified via the ''javaEncoding'' parameter of JspServlet. |
| jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within another jsp:attribute standard action |
| jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another jsp:body or jsp:attribute standard action |
| jsp.error.nested_jsproot=Nested <jsp:root> |
| jsp.error.no.more.content=End of content reached while more parsing required: tag nesting error? |
| jsp.error.no.scratch.dir=The JSP engine is not configured with a scratch dir.\n\ |
| \ Please add "jsp.initparams=scratchdir=<dir-name>" \n\ |
| \ in the servlets.properties file for this context. |
| jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration, <%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed here. |
| jsp.error.noFunction=The function [{0}] cannot be located with the specified prefix |
| jsp.error.noFunctionMethod=Method [{0}] for function [{1}] not found in class [{2}] |
| jsp.error.noFunctionPrefix=The function [{0}] must be used with a prefix when a default namespace is not specified |
| jsp.error.non_null_tei_and_var_subelems=Tag [{0}] has one or more variable subelements and a TagExtraInfo class that returns one or more VariableInfo |
| jsp.error.not.in.template=[{0}] not allowed in a template text body. |
| jsp.error.outputfolder=No output folder |
| jsp.error.overflow=Error: JSP Buffer overflow |
| jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple occurrences of ''autoFlush'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.buffer=Page directive: illegal to have multiple occurrences of ''buffer'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.contenttype=Page directive: illegal to have multiple occurrences of ''contentType'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple occurrences of ''errorPage'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.extends=Page directive: illegal to have multiple occurrences of ''extends'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.info=Page directive: illegal to have multiple occurrences of ''info'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple occurrences of ''isErrorPage'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple occurrences of ''isThreadSafe'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.language=Page directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.session=Page directive: illegal to have multiple occurrences of ''session'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.page.invalid.buffer=Page directive: invalid value for buffer |
| jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid value for deferredSyntaxAllowedAsLiteral |
| jsp.error.page.invalid.import=Page directive: invalid value for import |
| jsp.error.page.invalid.iselignored=Page directive: invalid value for isELIgnored |
| jsp.error.page.invalid.iserrorpage=Page directive: invalid value for isErrorPage |
| jsp.error.page.invalid.isthreadsafe=Page directive: invalid value for isThreadSafe |
| jsp.error.page.invalid.session=Page directive: invalid value for session |
| jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value for trimDirectiveWhitespaces |
| jsp.error.page.language.nonjava=Page directive: invalid language attribute |
| jsp.error.page.multi.pageencoding=Page directive must not have multiple occurrences of pageencoding |
| jsp.error.page.noSession=Cannot access session scope in page that does not participate in any session |
| jsp.error.param.invalidUse=The jsp:param action must not be used outside the jsp:include, jsp:forward, or jsp:params elements |
| jsp.error.paramexpected=Expecting "jsp:param" standard action with "name" and "value" attributes |
| jsp.error.params.emptyBody=jsp:params must contain at least one nested jsp:param |
| jsp.error.params.invalidUse=jsp:params must be a direct child of jsp:plugin |
| jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: [{0}] |
| jsp.error.parse.xml=XML parsing error on file [{0}] |
| jsp.error.parse.xml.line=XML parsing error on file [{0}]: (line [{1}], col [{2}]) |
| jsp.error.parse.xml.scripting.invalid.body=Body of [{0}] element must not contain any XML elements |
| jsp.error.plugin.badtype=Illegal value for 'type' attribute in jsp:plugin: must be 'bean' or 'applet' |
| jsp.error.plugin.nocode=code not declared in jsp:plugin |
| jsp.error.plugin.notype=type not declared in jsp:plugin |
| jsp.error.plugin.wrongRootElement=Name of root element in [{0}] different from [{1}] |
| jsp.error.prefix.refined=Attempt to redefine the prefix [{0}] to [{1}], when it was already defined as [{2}] in the current scope. |
| jsp.error.prefix.use_before_dcl=The prefix [{0}] specified in this tag directive has been previously used by an action in file [{1}] line [{2}]. |
| jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in jsp-property-group [{1}] |
| jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in page directive [{1}] |
| jsp.error.quotes.unterminated=Unterminated quotes |
| jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute [{0}] |
| jsp.error.security=Security initialization failed for context |
| jsp.error.servlet.destroy.failed=Exception during Servlet.destroy() for JSP page |
| jsp.error.setLastModified=Unable to set last modified date for file [{0}] |
| jsp.error.signature.classnotfound=The class [{0}] specified in the method signature in TLD for the function [{1}] cannot be found. [{2}] |
| jsp.error.simpletag.badbodycontent=The TLD for the class [{0}] specifies an invalid body-content (JSP) for a SimpleTag. |
| jsp.error.single.line.number=An error occurred at line: [{0}] in the jsp file: [{1}] |
| jsp.error.stream.close.failed=Failed to close stream |
| jsp.error.stream.closed=Stream closed |
| jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the attribute [{0}] with different values (old: [{1}], new: [{2}]) |
| jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}]) |
| jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for deferredSyntaxAllowedAsLiteral |
| jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored |
| jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for trimDirectiveWhitespaces |
| jsp.error.tag.language.nonjava=Tag directive: invalid language attribute |
| jsp.error.tag.multi.pageencoding=Tag directive must not have multiple occurrences of pageencoding |
| jsp.error.tagdirective.badbodycontent=Invalid body-content [{0}] in tag directive |
| jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path [{0}] |
| jsp.error.tagfile.illegalPath=Illegal tag file path: [{0}], must start with "/WEB-INF/tags" or "/META-INF/tags" |
| jsp.error.tagfile.missingPath=Path not specified to tag file |
| jsp.error.tagfile.nameFrom.badAttribute=The attribute directive declared at line [{1}] with name [{0}] that matches the name-from-attribute value of this variable directive must be of type java.lang.String, must be "required" and must not be a "rtexprvalue". |
| jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name [{0}] that matches the name-from-attribute value of this variable directive |
| jsp.error.tagfile.nameNotUnique=The value of [{0}] and the value of [{1}] in line [{2}] are the same. |
| jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: [{0}] cannot be resolved in either web.xml or the jar files deployed with this application |
| jsp.error.taglibDirective.both_uri_and_tagdir=Both 'uri' and 'tagdir' attributes specified |
| jsp.error.taglibDirective.missing.location=Neither 'uri' nor 'tagdir' attribute specified |
| jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for [{0}] |
| jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: [{0}] |
| jsp.error.text.has_subelement=<jsp:text> must not have any subelements |
| jsp.error.tld.fn.duplicate.name=Duplicate function name [{0}] in tag library [{1}] |
| jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD. Tag Library: [{0}], Function: [{1}] |
| jsp.error.tld.invalid_tld_file=Invalid tld file: [{0}], see JSP specification section 7.3.1 for more details |
| jsp.error.tld.mandatory.element.missing=Mandatory TLD element [{0}] missing or empty in TLD [{1}] |
| jsp.error.tld.missing_jar=Missing JAR resource [{0}] containing TLD |
| jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing TLD: [{1}] |
| jsp.error.tld.unable_to_read=Unable to read TLD [{1}] from JAR file [{0}]: [{2}] |
| jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator for [{0}] in [{1}] |
| jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class: [{0}] |
| jsp.error.unable.compile=Unable to compile class for JSP |
| jsp.error.unable.deleteClassFile=Unable to delete class file [{0}] |
| jsp.error.unable.load=Unable to load class for JSP |
| jsp.error.unable.renameClassFile=Unable to rename class file from [{0}] to [{1}] |
| jsp.error.unable.to_find_method=Unable to find setter method for attribute: [{0}] |
| jsp.error.unavailable=JSP has been marked unavailable |
| jsp.error.unbalanced.endtag=The end tag "</{0}" is unbalanced |
| jsp.error.undeclared_namespace=A custom tag was encountered with an undeclared namespace [{0}] |
| jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute [{0}]. |
| jsp.error.unsupported.encoding=Unsupported encoding: [{0}] |
| jsp.error.unterminated=Unterminated [{0}] tag |
| jsp.error.usebean.duplicate=useBean: Duplicate bean name: [{0}] |
| jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page declares (via page directive) that it does not participate in sessions |
| jsp.error.var_and_varReader=Only one of 'var' or 'varReader' may be specified |
| jsp.error.variable.alias=Both or none of the name-from-attribute and alias attributes must be specified in a variable directive |
| jsp.error.variable.both.name=Cannot specify both name-given and name-from-attribute attributes in a variable directive |
| jsp.error.variable.either.name=Either name-given or name-from-attribute attribute must be specified in a variable directive |
| jsp.error.xml.badStandardAction=Invalid standard action: [{0}] |
| jsp.error.xml.bad_tag=No tag [{0}] defined in tag library associated with uri [{1}] |
| jsp.error.xml.closeQuoteMissingInTextDecl=closing quote in the value following [{0}] in the text declaration is missing. |
| jsp.error.xml.closeQuoteMissingInXMLDecl=closing quote in the value following [{0}] in the XML declaration is missing. |
| jsp.error.xml.encodingByteOrderUnsupported=Given byte order for encoding [{0}] is not supported. |
| jsp.error.xml.encodingDeclInvalid=Invalid encoding name [{0}]. |
| jsp.error.xml.encodingDeclRequired=The encoding declaration is required in the text declaration. |
| jsp.error.xml.eqRequiredInTextDecl=The '' = '' character must follow [{0}] in the text declaration. |
| jsp.error.xml.eqRequiredInXMLDecl=The '' = '' character must follow [{0}] in the XML declaration. |
| jsp.error.xml.expectedByte=Expected byte [{0}] of [{1}]-byte UTF-8 sequence. |
| jsp.error.xml.invalidASCII=Byte [{0}] not 7-bit ASCII. |
| jsp.error.xml.invalidByte=Invalid byte [{0}] of [{1}]-byte UTF-8 sequence. |
| jsp.error.xml.invalidCharInContent=An invalid XML character (Unicode: 0x[{0}]) was found in the element content of the document. |
| jsp.error.xml.invalidCharInPI=An invalid XML character (Unicode: 0x[{0}]) was found in the processing instruction. |
| jsp.error.xml.invalidCharInTextDecl=An invalid XML character (Unicode: 0x[{0}]) was found in the text declaration. |
| jsp.error.xml.invalidCharInXMLDecl=An invalid XML character (Unicode: 0x[{0}]) was found in the XML declaration. |
| jsp.error.xml.invalidHighSurrogate=High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x[{0}]. |
| jsp.error.xml.morePseudoAttributes=more pseudo attributes is expected. |
| jsp.error.xml.noMorePseudoAttributes=no more pseudo attributes is allowed. |
| jsp.error.xml.operationNotSupported=Operation [{0}] not supported by [{1}] reader. |
| jsp.error.xml.pseudoAttrNameExpected=a pseudo attribute name is expected. |
| jsp.error.xml.quoteRequiredInTextDecl=The value following [{0}] in the text declaration must be a quoted string. |
| jsp.error.xml.quoteRequiredInXMLDecl=The value following [{0}] in the XML declaration must be a quoted string. |
| jsp.error.xml.reservedPITarget=The processing instruction target matching "[xX][mM][lL]" is not allowed. |
| jsp.error.xml.sdDeclInvalid=The standalone document declaration value must be "yes" or "no", not [{0}]. |
| jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl=White space is required before the encoding pseudo attribute in the text declaration. |
| jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl=White space is required before the encoding pseudo attribute in the XML declaration. |
| jsp.error.xml.spaceRequiredBeforeStandalone=White space is required before the encoding pseudo attribute in the XML declaration. |
| jsp.error.xml.spaceRequiredBeforeVersionInTextDecl=White space is required before the version pseudo attribute in the text declaration. |
| jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl=White space is required before the version pseudo attribute in the XML declaration. |
| jsp.error.xml.spaceRequiredInPI=White space is required between the processing instruction target and data. |
| jsp.error.xml.versionInfoRequired=The version is required in the XML declaration. |
| jsp.error.xml.versionNotSupported=XML version [{0}] is not supported, only XML 1.0 is supported. |
| jsp.error.xml.xmlDeclUnterminated=The XML declaration must end with "?>". |
| jsp.exception=An exception occurred processing [{0}] at line [{1}] |
| jsp.info.ignoreSetting=Ignored setting for [{0}] of [{1}] because a SecurityManager was enabled |
| jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated servlets |
| jsp.message.jsp_added=Adding JSP for path [{0}] to queue of context [{1}] |
| jsp.message.jsp_queue_created=Created jsp queue with length [{0}] for context [{1}] |
| jsp.message.jsp_queue_update=Updating JSP for path [{0}] in queue of context [{1}] |
| jsp.message.jsp_removed_excess=Removing excess JSP for path [{0}] from queue of context [{1}] |
| jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}] after [{2}] milliseconds |
| jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP count: [{1}] queue length: [{2}] |
| jsp.message.parent_class_loader_is=Parent class loader is: [{0}] |
| jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: [{0}] |
| jsp.tldCache.noTldInJar=No TLD files were found in [{0}]. Consider adding the JAR to the tomcat.util.scan.DefaultJarScanner.jarsToSkip or org.apache.catalina.startup.TldConfig.jarsToSkip property in CATALINA_BASE/conf/catalina.properties file. |
| jsp.tldCache.noTldSummary=At least one JAR was scanned for TLDs yet contained no TLDs. Enable debug logging for this logger for a complete list of JARs that were scanned but no TLDs were found in them. Skipping unneeded JARs during scanning can improve startup time and JSP compilation time. |
| jsp.warning.bad.urlpattern.propertygroup=Bad value [{0}] in the url-pattern subelement in web.xml |
| jsp.warning.checkInterval=Warning: Invalid value for the initParam checkInterval. Will use the default value of "300" seconds |
| jsp.warning.classDebugInfo=Warning: Invalid value for the initParam classdebuginfo. Will use the default value of "false" |
| jsp.warning.compiler.classfile.delete.fail=Failed to delete generated class file [{0}] |
| jsp.warning.compiler.classfile.delete.fail.unknown=Failed to delete generated class file(s) |
| jsp.warning.compiler.javafile.delete.fail=Failed to delete generated Java file [{0}] |
| jsp.warning.development=Warning: Invalid value for the initParam development. Will use the default value of "true" |
| jsp.warning.displaySourceFragment=Warning: Invalid value for the initParam displaySourceFragment. Will use the default value of "true" |
| jsp.warning.dumpSmap=Warning: Invalid value for the initParam dumpSmap. Will use the default value of "false" |
| jsp.warning.enablePooling=Warning: Invalid value for the initParam enablePooling. Will use the default value of "true" |
| jsp.warning.fork=Warning: Invalid value for the initParam fork. Will use the default value of "true" |
| jsp.warning.genchararray=Warning: Invalid value for the initParam genStringAsCharArray. Will use the default value of "false" |
| jsp.warning.jspIdleTimeout=Warning: Invalid value for the initParam jspIdleTimeout. Will use the default value of "-1" |
| jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated. Will use the default value of "false" |
| jsp.warning.mappedFile=Warning: Invalid value for the initParam mappedFile. Will use the default value of "false" |
| jsp.warning.maxLoadedJsps=Warning: Invalid value for the initParam maxLoadedJsps. Will use the default value of "-1" |
| jsp.warning.modificationTestInterval=Warning: Invalid value for the initParam modificationTestInterval. Will use the default value of "4" seconds |
| jsp.warning.noJarScanner=Warning: No org.apache.tomcat.JarScanner set in ServletContext. Falling back to default JarScanner implementation. |
| jsp.warning.quoteAttributeEL=Warning: Invalid value for the initParam quoteAttributeEL. Will use the default value of "false" |
| jsp.warning.recompileOnFail=Warning: Invalid value for the initParam recompileOnFail. Will use the default value of "false" |
| jsp.warning.suppressSmap=Warning: Invalid value for the initParam suppressSmap. Will use the default value of "false" |
| jsp.warning.trimspaces=Warning: Invalid value for the initParam trimSpaces. Will use the default value of "false" |
| jsp.warning.unknown.element.in.attribute=Unknown element [{0}] in attribute |
| jsp.warning.unknown.element.in.function=Unknown element [{0}] in function |
| jsp.warning.unknown.element.in.initParam=Unknown element [{0}] in validator''s init-param |
| jsp.warning.unknown.element.in.tag=Unknown element [{0}] in tag |
| jsp.warning.unknown.element.in.tagfile=Unknown element [{0}] in tag-file |
| jsp.warning.unknown.element.in.taglib=Unknown element [{0}] in taglib |
| jsp.warning.unknown.element.in.validator=Unknown element [{0}] in validator |
| jsp.warning.unknown.element.in.variable=Unknown element [{0}] in variable |
| jsp.warning.unknown.sourceVM=Unknown source VM [{0}] ignored |
| jsp.warning.unknown.targetVM=Unknown target VM [{0}] ignored |
| jsp.warning.unsupported.sourceVM=Unsupported source VM [{0}] requested, using [{1}] |
| jsp.warning.unsupported.targetVM=Unsupported target VM [{0}] requested, using [{1}] |
| jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy. Will use the default value of "false" |
| |
| jspc.delete.fail=Failed to delete file [{0}] |
| jspc.error.fileDoesNotExist=The file argument [{0}] does not exist |
| jspc.error.generalException=ERROR-the file [{0}] generated the following general exception: |
| jspc.generation.result=Generation completed with [{0}] errors in [{1}] milliseconds |
| jspc.implicit.uriRoot=uriRoot implicitly set to [{0}] |
| jspc.usage=Usage: jspc <options> [--] <jsp files>\n\ |
| where jsp files is\n\ |
| \ -webapp <dir> A directory containing a web-app, whose JSP pages\n\ |
| \ will be processed recursively\n\ |
| or any number of\n\ |
| \ <file> A file to be parsed as a JSP page\n\ |
| where options include:\n\ |
| \ -help Print this help message\n\ |
| \ -v Verbose mode\n\ |
| \ -d <dir> Output Directory (default -Djava.io.tmpdir)\n\ |
| \ -l Outputs the name of the JSP page upon failure\n\ |
| \ -s Outputs the name of the JSP page upon success\n\ |
| \ -p <name> Name of target package (default org.apache.jsp)\n\ |
| \ -c <name> Name of target class name (only applies to first JSP page)\n\ |
| \ -mapped Generates separate write() calls for each HTML line in the JSP\n\ |
| \ -die[#] Generates an error return code (#) on fatal errors (default 1)\n\ |
| \ -uribase <dir> The uri directory compilations should be relative to\n\ |
| \ (default "/")\n\ |
| \ -uriroot <dir> Same as -webapp\n\ |
| \ -compile Compiles generated servlets\n\ |
| \ -failFast Stop on first compile error\n\ |
| \ -webinc <file> Creates a partial servlet mappings in the file\n\ |
| \ -webfrg <file> Creates a complete web-fragment.xml file\n\ |
| \ -webxml <file> Creates a complete web.xml in the file\n\ |
| \ -webxmlencoding <enc> Set the encoding charset used to read and write the web.xml\n\ |
| \ file (default is platform default encoding)\n\ |
| \ -addwebxmlmappings Merge generated web.xml fragment into the web.xml file of the\n\ |
| \ web-app, whose JSP pages we are processing\n\ |
| \ -ieplugin <clsid> Java Plugin classid for Internet Explorer\n\ |
| \ -classpath <path> Overrides java.class.path system property\n\ |
| \ -xpoweredBy Add X-Powered-By response header\n\ |
| \ -trimSpaces Remove template text that consists entirely of whitespace\n\ |
| \ -javaEncoding <enc> Set the encoding charset for Java classes (default UTF-8)\n\ |
| \ -source <version> Set the -source argument to the compiler (default 1.6)\n\ |
| \ -target <version> Set the -target argument to the compiler (default 1.6)\n\ |
| \ -threadCount <count> Number of threads to use for compilation.\n\ |
| \ ("2.0C" means two threads per core)\n |
| jspc.webfrg.footer=\n\ |
| </web-fragment>\n\ |
| \n |
| jspc.webfrg.header=<?xml version="1.0" encoding="{0}"?>\n\ |
| <web-fragment xmlns="http://java.sun.com/xml/ns/javaee"\n\ |
| \ xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"\n\ |
| \ xsi:schemaLocation="http://java.sun.com/xml/ns/javaee\n\ |
| \ http://java.sun.com/xml/ns/javaee/web-fragment_3_0.xsd"\n\ |
| \ version="3.0"\n\ |
| \ metadata-complete="true">\n\ |
| \ <name>org_apache_jasper.jspc</name>\n\ |
| \ <distributable/>\n\ |
| <!--\n\ |
| Automatically created by Apache Tomcat JspC.\n\ |
| -->\n\ |
| \n |
| jspc.webinc.footer=\n\ |
| <!--\n\ |
| End of content automatically created by Apache Tomcat JspC.\n\ |
| -->\n\ |
| \n |
| jspc.webinc.header=\n\ |
| <!--\n\ |
| Automatically created by Apache Tomcat JspC.\n\ |
| -->\n\ |
| \n |
| jspc.webinc.insertEnd=<!-- JSPC servlet mappings end --> |
| jspc.webinc.insertStart=<!-- JSPC servlet mappings start --> |
| jspc.webxml.footer=\n\ |
| </web-app>\n\ |
| \n |
| jspc.webxml.header=<?xml version="1.0" encoding="{0}"?>\n\ |
| <web-app xmlns="http://java.sun.com/xml/ns/javaee"\n\ |
| \ xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"\n\ |
| \ xsi:schemaLocation="http://java.sun.com/xml/ns/javaee\n\ |
| \ http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd"\n\ |
| \ version="3.0"\n\ |
| \ metadata-complete="false">\n\ |
| <!--\n\ |
| Automatically created by Apache Tomcat JspC.\n\ |
| -->\n\ |
| \n |
| |
| org.apache.jasper.compiler.ELParser.invalidQuotesForStringLiteral=The String literal [{0}] is not valid. It must be contained within single or double quotes. |
| org.apache.jasper.compiler.ELParser.invalidQuoting=The expression [{0}] is not valid. Within a quoted String only [], [''] and ["] may be escaped with []. |
| |
| xmlParser.skipBomFail=Failed to skip BOM when parsing XML input stream |
